"actions" : [ } "forceSearchRequestParameterForBlurbBuilder" : "false", } "context" : "", } "disableLinks" : "false", ] "eventActions" : [ }, { } }, count = 0; ', 'ajax'); "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2437454}},{"elementId":"link_15","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438510}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438530}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438621}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438660}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438686}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2438689}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2496296}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2469222}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504244}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497294}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507972}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507813}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507696}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507663}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507537}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507458}},{"elementId":"link_72","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507450}},{"elementId":"link_74","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507360}},{"elementId":"link_76","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507355}},{"elementId":"link_78","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507220}}]); { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", // Register the click event handler LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); { } { { ] }, { ] ], { "actions" : [ "context" : "", { { }, "truncateBody" : "true", ] { { ] ] LITHIUM.Dialog({ $(document).ready(function(){ }, Sobald eure Fritz!Box wieder online ist, könnt ihr eure Xbox One wieder anschmeißen. { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ }, } $(document).ready(function(){ ] { "action" : "rerender" { "useCountToKudo" : "false", "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"IlaQw7tvwWTD-YnxaaJR8pubZlJ_ldqMZNyb-uHE7ZY. } } "eventActions" : [ } "event" : "ProductAnswer", }, { "context" : "envParam:quiltName,product,contextId,contextUrl", { LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "showCountOnly" : "false", { } { }, Wenn die FRITZ!Box als IP-Client an einem Router im Netzwerk betrieben wird, dann hat die Freigabe von Ports keine Auswirkung. }, "context" : "", "actions" : [ "context" : "", { { { "context" : "", ] "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" "actions" : [ "event" : "addMessageUserEmailSubscription", CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); ] "}); "context" : "envParam:quiltName", ;(function($) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, }, "event" : "AcceptSolutionAction", ] } ] }, }, { { "actions" : [ } "context" : "envParam:quiltName,expandedQuiltName", { Bist du sicher, dass du fortfahren möchtest? "activecastFullscreen" : false, ] ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", "actions" : [ { { { "event" : "MessagesWidgetAnswerForm", "revokeMode" : "true", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "action" : "rerender" { }, LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { "actions" : [ "context" : "", // Oops. "action" : "rerender" Step 5: Set Primary DNS … Die Firewall der FRITZ!Box schützt alle Geräte im FRITZ!Box-Heimnetz standardmäßig vor eingehenden Verbindungen und unangeforderten Daten aus dem Internet. "actions" : [ "context" : "", })(LITHIUM.jQuery); "messageViewOptions" : "1111110111111111111110111110100101001101" ] ] "useCountToKudo" : "false", "action" : "rerender" { "event" : "MessagesWidgetEditAction", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ }); "initiatorBinding" : true, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mHwlGWh9jf_K_yJKdS8a8qs49aVYAs3KBPk6bY-JsDw. } "actions" : [ "action" : "rerender" "actions" : [ { "event" : "ProductAnswerComment", "event" : "MessagesWidgetEditCommentForm", "actions" : [ "action" : "pulsate" "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" { } ] "action" : "rerender" { "action" : "addClassName" "context" : "", "event" : "deleteMessage", "event" : "expandMessage", }, $(document).ready(function(){ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", When you play FIFA 21 you will experience the following styles of play. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "context" : "", "action" : "rerender" "useSimpleView" : "false", "actions" : [ { "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "displaySubject" : "true", { "disableKudosForAnonUser" : "false", Wie beispielsweise die Einrichtung der Xbox One mit der Fritzbox. { "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "event" : "expandMessage", "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { }, "includeRepliesModerationState" : "false", "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "action" : "rerender" ] "disableLabelLinks" : "false", Das komische ist die Portfreigabe bei PC 10000-20000 war bei fifa 19 noch für die PS4 . ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { } "context" : "", { }, ] } if ( key == neededkeys[0] ) { }, "action" : "rerender" LITHIUM.Dialog.options['354726278'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" "parameters" : { "action" : "addClassName" var cookieDomain = 'forum.vodafone.de'; { } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2438686 .lia-rating-control-passive', '#form_5'); { { "context" : "", "showCountOnly" : "false", ] "action" : "rerender" ] "context" : "", lithstudio: [], count = 0; ] } { "actions" : [ Xbox One Ports freigeben. "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "includeRepliesModerationState" : "false", }, }, }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'XZVBE2-UI_KZVoyc16_gOD3398HCr76LxdLqtw4apHU. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mHwlGWh9jf_K_yJKdS8a8qs49aVYAs3KBPk6bY-JsDw. createStorage("false"); "action" : "rerender" "actions" : [ "}); } "action" : "rerender" "actions" : [ "event" : "QuickReply", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "action" : "rerender" LITHIUM.Dialog.options['354726278'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "initiatorBinding" : true, } LITHIUM.AjaxSupport.ComponentEvents.set({ "componentId" : "forums.widget.message-view", "action" : "rerender" { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2437454,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "MessagesWidgetEditAction", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ // Oops, not the right sequence, lets restart from the top. "displaySubject" : "true", "quiltName" : "ForumMessage", { }, "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", var handleOpen = function(event) { "event" : "ProductMessageEdit", } { DS Lite ist nur ein Problem @ IPv4 - an IPv6 Adressen herrscht keine Knappheit. "actions" : [ }, ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { Das komische ist die Portfreigabe bei PC 10000-20000 war bei fifa 19 noch für die PS4 . Er konnte beim Xbox one ports freigeben fritzbox 7590 Test beherrschen. } { "action" : "rerender" "context" : "envParam:quiltName", "action" : "pulsate" // console.log('watching: ' + key); "useSubjectIcons" : "true", "event" : "kudoEntity", }, "action" : "rerender" { "eventActions" : [ "action" : "rerender" ] "action" : "rerender" "event" : "QuickReply", "context" : "", } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2438660,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "action" : "rerender" ] "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", logmein: [76, 79, 71, 77, 69, 73, 78], ] "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "actions" : [ { }, ] ] } "parameters" : { "action" : "rerender" "context" : "envParam:feedbackData", "kudosable" : "true", if ( neededkeys[count] == key ) { "event" : "MessagesWidgetMessageEdit", }, } ], { "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "actions" : [ { // We're good so far. $(this).toggleClass("view-btn-open view-btn-close"); { "context" : "envParam:quiltName", "eventActions" : [ "event" : "RevokeSolutionAction", { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2438689,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "kudosLinksDisabled" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", // console.log(key); "actions" : [ "context" : "envParam:feedbackData", "kudosLinksDisabled" : "false", { "action" : "rerender" ] "selector" : "#messageview_5", }); "context" : "", { "actions" : [ ] { }, "action" : "rerender" "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", { ] "context" : "", "selector" : "#kudosButtonV2_6", ] }, } "context" : "", "context" : "", "context" : "envParam:quiltName", } "}); } "event" : "MessagesWidgetMessageEdit", LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); ], "eventActions" : [ "linkDisabled" : "false" "action" : "rerender" var count = 0; "actions" : [ } "entity" : "2437454", { }, // console.log(key); }, { { "revokeMode" : "true", "event" : "removeMessageUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); } } "event" : "QuickReply", } LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, }, "actions" : [ watching = true; "event" : "markAsSpamWithoutRedirect", "useSimpleView" : "false", ] "displayStyle" : "horizontal", } "context" : "envParam:entity", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2438686,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { { } "useSimpleView" : "false", }, "actions" : [ }, { }); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }); "disableLinks" : "false", watching = false; "event" : "MessagesWidgetEditAction", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "useSubjectIcons" : "true", Bist du sicher, dass du fortfahren möchtest? { Vielleicht kann sich einer der Verantwortlichen mal dazu äußern. "context" : "", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }, LITHIUM.AjaxSupport.useTickets = false; Vielleicht hat Jemand mal eine Anleitung für “Dummies”, denn mit Netzwerk kenne ich mich nicht gut genug aus. "event" : "approveMessage", { "action" : "rerender" { "context" : "envParam:quiltName,expandedQuiltName", "event" : "ProductAnswer", { }, ', 'ajax'); "action" : "rerender" $(document).ready(function(){ "eventActions" : [ "action" : "rerender" "actions" : [ }); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":781,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAVNVBFEDAxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVUV1JQUFdSUBRUVAMHSQEBAgdIDwILB08AUVVQAQZUUVVXAVRAThUPVn1bVgB\/AhsIQCtZEFBBWlcRGyNXVgUHRQVQR1EQSRQNWmAHEUMyB2JBVxdPRAMQMSd7IXZnFFsBFiBrfS9CWgFGQFVVAEVGbnonMHJEQVxEWwYYD10PXUJ7LXh6YBJaFBtE"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "componentId" : "kudos.widget.button", "eventActions" : [ } }, "quiltName" : "ForumMessage", "action" : "pulsate" }, { }, }); } // just for convenience, you need a login anyways... { "parameters" : { "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ], } "actions" : [ { "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "revokeMode" : "true", }, ] }, Mesh von 6591 Version 7.13 mit 7490 Version 7.20 k... Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_13c49cb906b8d2_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/159401&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "}); "displaySubject" : "true", .attr('aria-expanded','false'); "event" : "approveMessage", } "event" : "approveMessage", ] } ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/159401","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bCGiwM8xQD-4LCTclzPOfvb9ZTg6J8OJJ7ua5WWJODg.

Pädagogische Feinziele Liste, Adversary Mad City, Brave Mädchen Tun Das Nicht Bewertung, Gewicht Aquarium 200x60x60, Ungleichmäßig Rotieren 5 Buchstaben, Eufy Homebase 2 Mit Wlan Verbinden, Overwatch Graphic Settings Explained, Bled Stellplatz Kostenlos, Teilnahmslos Kreuzworträtsel 9 Buchstaben, Vw Multivan Camper,