LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "message" : "2383529", } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2213965,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. if (typeof(Storage) !== "undefined") { { createStorage("true"); "context" : "envParam:quiltName", "context" : "", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); } }, "}); ] "action" : "rerender" { { })(LITHIUM.jQuery); "selector" : "#messageview", { "actions" : [ }, "parameters" : { { "action" : "pulsate" "context" : "", "revokeMode" : "true", }); "actions" : [ ] { Mit dem Service MOBILES BEZAHLEN kaufst Du mit Deinem Smartphone ganz einfach Apps und Spiele oder auch Abos von Drittanbietern. "actions" : [ "event" : "kudoEntity", }, "event" : "MessagesWidgetMessageEdit", "context" : "", "context" : "", "event" : "RevokeSolutionAction", { } "action" : "rerender" "actions" : [ { }, "context" : "envParam:feedbackData", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "AcceptSolutionAction", }, "context" : "lia-deleted-state", ] "componentId" : "kudos.widget.button", "actions" : [ "actions" : [ { "showCountOnly" : "false", }, Nicht umsonst bieten die meisten der beliebtesten Online-Shops in Deutschland PayPal als Zahlungsmittel an – abgesehen von Amazon. { }, { LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetMessageEdit", ] $('#vodafone-community-header .lia-search-toggle').click(function() { "context" : "", "useSimpleView" : "false", PayPal können Sie dank Vodafone nun auch in Deutschland im Laden um die Ecke verwenden – allerdings nur unter ganz bestimmten Voraussetzungen. }, }); { }, LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "}); } "actions" : [ { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2213965 .lia-rating-control-passive', '#form_0'); "event" : "MessagesWidgetAnswerForm", }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); ), Viele Voraussetzungen für PayPal in der Vodafone Wallet (NFC-SIM-Card, usw. "includeRepliesModerationState" : "false", { "action" : "rerender" "context" : "", "actions" : [ "action" : "rerender" })(LITHIUM.jQuery); { ] }); "actions" : [ "action" : "rerender" "action" : "rerender" "triggerSelector" : ".lia-panel-dialog-trigger-event-click", Please click on confirm to proceed ahead. LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; LITHIUM.Loader.runJsAttached(); }, "initiatorBinding" : true, }); "accessibility" : false, "actions" : [ { { ] ] "event" : "ProductMessageEdit", } "useSimpleView" : "false", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234295}); "buttonDialogCloseAlt" : "Schließen", ;(function($) { "displayStyle" : "horizontal", "context" : "envParam:entity", "forceSearchRequestParameterForBlurbBuilder" : "false", ] { var keycodes = { { { var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "useCountToKudo" : "false", { "actions" : [ ] { window.location = "https://forum.vodafone.de/t5/Mobilfunk/Handyrechnung-per-Paypal-bezahlen/td-p/2213898" + "/page/" + 1; "actions" : [ { "forceSearchRequestParameterForBlurbBuilder" : "false", ], "context" : "envParam:quiltName,message,product,contextId,contextUrl", "truncateBody" : "true", "disableLinks" : "false", "action" : "addClassName" "context" : "envParam:quiltName,product,contextId,contextUrl", }, } "initiatorDataMatcher" : "data-lia-kudos-id" "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2213898 .lia-rating-control-passive', '#form'); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2383529 .lia-rating-control-passive', '#form_2'); ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. "event" : "approveMessage", "action" : "rerender" "selector" : "#messageview_2", } { { } "context" : "", "context" : "", // We're good so far. "}); "action" : "rerender" } LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. Zu den Akzeptanzstellen für die Vodafone Wallet gehören die folgenden Unternehmen (Stand: 03/2017): Laut der Digital-Payment-Studie von Visa (Stand: 10/2016) haben im Jahr 2016 mehr als ein Drittel (35 Prozent) der deutschen Befragten kontaktlos per Karte bezahlt. "selector" : "#kudosButtonV2_2", "event" : "AcceptSolutionAction", { { "messageViewOptions" : "1111110111111111111110111110100101001101" }, bei Verlust/Diebstahl, NFC-fähige Terminals sind noch nicht flächendeckend verfügbar, Erzwungener Vertragsabschluss bei britischer Bank, Deutsche misstrauen vielen technischen Zahllösungen. ], } "disableLabelLinks" : "false", "actions" : [ ;(function($) { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "initiatorDataMatcher" : "data-lia-kudos-id" $(this).removeClass('active'); { "message" : "2383529", "initiatorBinding" : true, "context" : "", })(LITHIUM.jQuery); "event" : "deleteMessage", "event" : "MessagesWidgetAnswerForm", "actions" : [ "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); Invalid Amount . { "truncateBodyRetainsHtml" : "false", Huawei P10 4. }, "entity" : "2383529", ] { LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'NNaRmBuL9NC-NLKoJVDxr-WGcM9EG81qypD59O6cQWE. "event" : "QuickReply", "context" : "", if ( neededkeys[count] == key ) { }; }, "kudosable" : "true", ] "action" : "pulsate" { { } "useCountToKudo" : "false", "actions" : [ ] "initiatorDataMatcher" : "data-lia-message-uid" ] ] { "action" : "rerender" }, "action" : "rerender" "kudosLinksDisabled" : "false", "action" : "rerender" "context" : "lia-deleted-state", "parameters" : { { "action" : "rerender" } LITHIUM.AjaxSupport.ComponentEvents.set({ { "actions" : [ } ] }, LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2213898}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2213965}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2382972}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2383529}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2449428}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2486396}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2449853}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2503283}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2502972}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508216}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508128}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508124}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508092}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507919}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507905}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507896}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507893}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507805}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507763}}]); "action" : "rerender" { "eventActions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, ] ;(function($) { window.location.replace('/t5/user/userloginpage'); // just for convenience, you need a login anyways... }, "parameters" : { }, "action" : "rerender" OneNumber Tablet / Young M / Vodafone Pass/ EasyTr... Kündigungsfrist verpasst, könnten Sie mir bitte we... Neue SIM Karte wegen Upgrade Kabelanschluss? } { }, ] })(LITHIUM.jQuery); { "event" : "AcceptSolutionAction", "actions" : [ "event" : "addThreadUserEmailSubscription", { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); }, Vodafone’s agreement with PayPal allows consumers to sign up for a PayPal … "disableKudosForAnonUser" : "false", $('#custom-overall-notif-count').html(notifCount); watching = false; "action" : "rerender" var key = e.keyCode; ] { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "message" : "2213898", "truncateBody" : "true", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { "event" : "ProductAnswerComment", "useSimpleView" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2213965,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "showCountOnly" : "false", { } "context" : "", Übrigens: Vodafone hat SmartPass im Jahr 2016 eingestellt – auch wenn das Unternehmen auf der eigenen Webseite immer noch auf den ehemaligen Bezahldienst verweist (Stand: 03/2017). LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2382972 .lia-rating-control-passive', '#form_1'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/238472","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_FKY0rSztGDVlUbKrLMPWm9bh1Taj-AnFrVgDRlaxJo. //resetMenu(); ;(function($) { "actions" : [ { Bestätige Deinen Einkauf. { "actions" : [ { "action" : "rerender" "context" : "envParam:quiltName,message", "actions" : [ "disableKudosForAnonUser" : "false", "actions" : [ "useCountToKudo" : "false", } Skype: Iodas123 "event" : "deleteMessage", "closeEvent" : "LITHIUM:lightboxCloseEvent", Weltweit hat das Unternehmen annährend 200 Millionen aktive Kontoinhaber. } "forceSearchRequestParameterForBlurbBuilder" : "false", Akzeptieren Sie anschließend die Berechtigung für Vodafone. "actions" : [ }, "action" : "rerender" { "useTruncatedSubject" : "true", "linkDisabled" : "false" "context" : "", }); } }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "actions" : [ resetMenu(); "event" : "RevokeSolutionAction", Pay Pal und Apple setzen bereits auf die Methode, um sie zukünftig ihren Kunden anbieten zu können. Bist du sicher, dass du fortfahren möchtest? { } "action" : "rerender" } }, Für Zahlungen über 25 Euro müssen Sie immer Ihre persönliche Geheimzahl eingeben. { "event" : "AcceptSolutionAction", }, ], "event" : "deleteMessage", } }, }); { { "actions" : [ "message" : "2382972", "event" : "RevokeSolutionAction", Bezahlen Sie Beträge mit einem Wert von unter 25 Euro, ist in der Regel keine weitere Bestätigung nötig. Never miss a sale just because you don’t have the right tools. }, "event" : "MessagesWidgetEditAction", { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'q8OuNN-nX5oDmdTwVXa_F9Gi6XmlnoBuReURovTFCSM. "actions" : [ "truncateBodyRetainsHtml" : "false", { "accessibility" : false, "context" : "envParam:selectedMessage", } "linkDisabled" : "false" "useSimpleView" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2213898,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Vodafone aufladen paypal by alpham digital merce b v google play guthaben per paypal so laden sie ihre prepaid sim karte auf prepaid mit paypal aufladung seVodafone Guthaben Abfragen Und Konto AufladenVodafone 15 Aufladen Schnell Zuverlässig Guthaben Direkt DeVodafone Aufladen Paypal Kaufe Ab 15Callya Prepaid Karte Aufladen VodafoneCallya Prepaid Karte Aufladen … "action" : "pulsate" LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "actions" : [ "action" : "addClassName" ] ;(function($) { "action" : "rerender" }, }, "action" : "rerender" $(document).ready(function(){ ] // enable redirect to login page when "logmein" is typed into the void =) "eventActions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { // Oops. "context" : "envParam:selectedMessage", } "action" : "rerender" Die Anwendung bietet Ihnen zudem eine detaillierte Echtzeit-Zahlungshistorie mit konkretem Ort und Datum jeder Zahlung. "eventActions" : [ "componentId" : "forums.widget.message-view", } LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "useCountToKudo" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "MessagesWidgetEditCommentForm", "}); "action" : "rerender" watching = true; } "action" : "pulsate" ] "action" : "rerender" "action" : "pulsate" "context" : "envParam:quiltName", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "event" : "MessagesWidgetEditCommentForm", "actions" : [ document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); ] { }); "actions" : [ "useCountToKudo" : "false", Nähere Infos dazu findest Du im Eilmeldungsboard. "action" : "rerender" "action" : "rerender" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { "action" : "rerender" } }, PayPal: paypal.com $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, LITHIUM.AjaxSupport.useTickets = false; LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Bs27o6CGq46irX0kKZrc6ZydNCWNZ-ODhJmic0mKFSk. }, "event" : "ProductAnswerComment", "actions" : [ { window.onload = function() { } "event" : "markAsSpamWithoutRedirect", "actions" : [ })(LITHIUM.jQuery); // Pull in global jQuery reference { "action" : "rerender" } // We're good so far. } { } "closeEvent" : "LITHIUM:lightboxCloseEvent", { "event" : "deleteMessage", } $('#vodafone-community-header').toggle(); }, }, } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); })(LITHIUM.jQuery); // Pull in global jQuery reference lithstudio: [], "kudosLinksDisabled" : "false", // console.log('watching: ' + key); "context" : "", "context" : "envParam:quiltName,expandedQuiltName", } ] "truncateBodyRetainsHtml" : "false", "disallowZeroCount" : "false", ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "action" : "rerender" LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2213898}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2213965}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2382972}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2383529}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2449428}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2486396}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2449853}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2503283}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2502972}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508216}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508128}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508124}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508092}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507919}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507905}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507896}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507893}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507805}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507763}}]); ] "parameters" : { "actions" : [ { "event" : "AcceptSolutionAction", }); } } { "action" : "pulsate" "event" : "markAsSpamWithoutRedirect", "parameters" : { "actions" : [ { "action" : "rerender" LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); { LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "actions" : [ "actions" : [ $(this).next().toggle(); } }, "actions" : [ } "actions" : [ LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating');

12 Ssw Kein Ziehen Im Unterleib, Wie Viele Media Markt Filialen Gibt Es, Hotmail Login Problem, Tiergesichter Roter Hahn, Stadt Trier Stellenangebote, Duales Studium Stadt Leipzig Vergütung, Gute Psychologen In Meiner Nähe, Zypern Urlaub Strand,